Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase H/PPIH (N-6His)

Source: E.coli. MW :21.4kD. Recombinant Human PPIase H is produced by our E.coli expression system and the target gene encoding Met1-Met177 is expressed with a 6His tag at the N-terminus. Peptidyl-Prolyl Cis-Trans Isomerase H (PPIH) belongs to the Cyclophilin-type PPIase family that accelerate the folding of proteins. PPIases can catalyze the cis-trans isomerization of Proline Imidic peptide bonds in oligopeptides. PPIH participates in pre-mRNA splicing. It is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. In addition, PPIH has PPIase activity and may play a role as a chaperone mediating the interactions between different proteins inside the spliceosome.

Product Specifications

Gene Name

PPIH

Gene ID

10465

UniProt

O43447

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Taar2 shRNA (UAS) - Lentiviral mouse Taar2 shRNA (UAS, iRFP) (100)
GTR15301878 1 Vial

Lentiviral mouse Taar2 shRNA (UAS) - Lentiviral mouse Taar2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CD24 (GPI-linked surface Mucin, Nectadrin) (MaxLight 490) discontinued
C2275-07-ML490 100 µL

CD24 (GPI-linked surface Mucin, Nectadrin) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Mindy3 shRNA (UAS) - Lentiviral mouse Mindy3 shRNA (UAS) (25)
GTR15274049 1 Vial

Lentiviral mouse Mindy3 shRNA (UAS) - Lentiviral mouse Mindy3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human Cystatin-A (CSTA) Antibody (Biotin Conjugate)
32532-05121 150 µg

Human Cystatin-A (CSTA) Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
NF-κΒ activator 2
HY-134477-01 5 mg

NF-κΒ activator 2

Sign In for Pricing
View Details
NF-κΒ activator 2
HY-134477-02 10 mg

NF-κΒ activator 2

Sign In for Pricing
View Details