Recombinant Protein G
Selected Variant
32-4510-10
Size: 10 mg
Source : Escherichia Coli The Protein G is a single, non-glycosylated protein contains 200 amino acids having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.
Product Specifications
Purification
>96% as determined by SDS-PAGE and RP-HPLC.
Components
Lyophilized white powder containing no additives.
Storage Conditions
Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Applications Notes
Reconstitution with deionized water or PBS.
Amino Acids
LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740198-100 1x 100 µL
Cytokeratin 18 (DA7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PA1874-Cy3 100 µg/Vial
Anti-CD163 Antibody Picoband®, Cy3 Conjugate
Sign In for Pricing
View Details 
BNCB2299-100 1x 100 µL
Estrogen Receptor, alpha (Marker of Estrogen Dependence) (ESR1/2299R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940102-100 1x 100 µL
Golgi Complex (371-4), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1147-500 1x 500 µL
CD45RB (PTPRC/1147), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401840-100 1x 100 µL
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details