Recombinant Protein G
Source : Escherichia Coli The Protein G is a single, non-glycosylated protein contains 200 amino acids having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.
Product Specifications
Purification
>96% as determined by SDS-PAGE and RP-HPLC.
Components
Lyophilized white powder containing no additives.
Storage Conditions
Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Applications Notes
Reconstitution with deionized water or PBS.
Amino Acids
LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882559-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
KN422157 1 Kit
mLX interacting protein (mLXIP) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
