IL 1 beta Rat
Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.
Product Specifications
Swiss Prot
Q63264
Source
Escherichia Coli.
Buffer
The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.
Storage Conditions
Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
GTR15237030 1 Vial
Lentiviral mouse Lratd2 shRNA (UAS) - Lentiviral mouse Lratd2 shRNA (UAS) (100)
Ask
View Details 