Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2L3 His Recombinant Protein

Source : Escherichia Coli. Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids.The UBE2L3 protein contains 6xHis tag and is purified by proprietary chromatographic techniques. Human Ubquitin Conjugating Enzyme 7 (UbcH7) is a class I enzyme which functions in the stress response and the control of transcription factors. The enzyme is ubiquitously expressed with high levels of expression seen in adult muscle. UbcH7 mediates the selective degradation of short-lived and abnormal proteins and is highly homologous to UbcH5. It has been demonstrated to participate in the ubiquitinylation of p53, c-Fos and NF-kB. UbcH7 is one of two E2s (UbcH5 being the other) with which HECT domain proteins interact with UbcH7 being able to efficiently substitute for UbcH5 in E6-AP-dependent ubiquitinylation.

Product Specifications

Product Name Alternative

Ubiquitin-conjugating enzyme E2 L3||EC 6.3.2.19||Ubiquitin-protein ligase L3, Ubiquitin carrier protein L3||UbcH7||E2-F1||L-UBC||UbcM4.

Purification

Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Lyophilized from a 0.2μm filtered concentrated (1 mg/mL) solution in 1X PBS and 1mM DTT, pH 7.5.

Storage Conditions

Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Smad3 (Ab-208)
Y021324 100 µg

Anti-Smad3 (Ab-208)

Sign In for Pricing
View Details
Mucin 2 (MUC2, Mucin-2) (APC)
138573-AF-APC 100 µL

Mucin 2 (MUC2, Mucin-2) (APC)

Sign In for Pricing
View Details
Zinc Finger Protein 239 (ZNF239) Antibody
abx036642-01 100 µg

Zinc Finger Protein 239 (ZNF239) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 239 (ZNF239) Antibody
abx036642-02 1 mg

Zinc Finger Protein 239 (ZNF239) Antibody

Sign In for Pricing
View Details
Mouse Integrin alpha 7 Alexa Fluor 647 Antibody
FAB3518R-100UG 100 µg

Mouse Integrin alpha 7 Alexa Fluor 647 Antibody

Sign In for Pricing
View Details
ATP sodium solution
HBP001905 100 µL

ATP sodium solution

Sign In for Pricing
View Details