Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5H4P 3'UTR Luciferase Stable Cell Line

Product Specifications

No additional specifications available.

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
GM CSF (CSF2) Human Gene Knockout Kit (CRISPR)
KN411109 1 Kit

GM CSF (CSF2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Galectin 2 GAL2 ELISA Kit
BG-MUS11043 1 Each

Mouse Galectin 2 GAL2 ELISA Kit

Sign In for Pricing
View Details
Tsks sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6295906 1.0 µg DNA

Tsks sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rat Rimoc1 Pre-designed siRNA Set B
SI211929B 1 Each

Rat Rimoc1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ENO1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61116R-BF405-01 20 µL

ENO1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details