Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphotoxin-alpha (LTA) (Active)

Product Specifications

Product Name Alternative

Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necrosis Factor Ligand Superfamily Member 1; LTA; TNFB; TNFSF1

Abbreviation

Recombinant Human LTA protein (Active)

Gene Name

LTA

UniProt

P01374

Expression Region

35-205aa

Organism

Homo sapiens (Human)

Target Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Tumor Necrosis Factor β (TNF-β) is a secreted protein belonging to the tumor necrosis factor family. TNF-β binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds to TNFRSF3/LTBR in heterotrimeric form with LTB. TNF-β forms heterotrimers with lymphotoxin-beta, which anchors TNF-β to the cell surface. TNF-β mediates the inflammatory, immunostimulatory, and antiviral response, involves in the formation of second lymphoid organs during development, has a role in apoptosis. TNF-β is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 20-80 pg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC8 3'UTR Lenti-reporter-Luc Vector
19412081 1.0 µg

ERCC8 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PDP1 ([Pyruvate Dehydrogenase [Acetyl- transferring]]-Phosphatase 1, Mitochondrial, Protein Phosphatase 2C, Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 1, PDPC 1, PDP, PPM2C) discontinued
360953-01 50 µL

PDP1 ([Pyruvate Dehydrogenase [Acetyl- transferring]]-Phosphatase 1, Mitochondrial, Protein Phosphatase 2C, Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 1, PDPC 1, PDP, PPM2C) discontinued

Sign In for Pricing
View Details
PDP1 ([Pyruvate Dehydrogenase [Acetyl- transferring]]-Phosphatase 1, Mitochondrial, Protein Phosphatase 2C, Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 1, PDPC 1, PDP, PPM2C) discontinued
360953-02 100 µL

PDP1 ([Pyruvate Dehydrogenase [Acetyl- transferring]]-Phosphatase 1, Mitochondrial, Protein Phosphatase 2C, Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 1, PDPC 1, PDP, PPM2C) discontinued

Sign In for Pricing
View Details
Recombinant Human Membrane Primary Amine Oxidase/AOC3 (C-6His)
C927-1mg 1 mg

Recombinant Human Membrane Primary Amine Oxidase/AOC3 (C-6His)

Sign In for Pricing
View Details
Recombinant Human Vitronectin/VTN (C-6His)
32-7360-10 10 µg

Recombinant Human Vitronectin/VTN (C-6His)

Sign In for Pricing
View Details
Biotin-13C5
HY-B0511S3 1 Each

Biotin-13C5

Sign In for Pricing
View Details