I-TAC/CXCL11, Mouse
The CXCL11 protein selectively attracts interleukin-activated T cells and induces calcium release in these cells. Its binding to CXCR3 suggests a complex role in T cell chemotaxis and may be important in CNS diseases involving T cell recruitment. I-TAC/CXCL11 Protein, Mouse is the recombinant mouse-derived CXCL11 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
I-TAC/CXCL11 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Purity
98.00
Smiles
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Molecular Formula
56066 (Gene_ID) Q9JHH5 (F22-M100) (Accession)
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
GPR73B (PROKR2) (NM_144773) Human Tagged ORF Clone Lentiviral Particle
