Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1C Peptide - middle region

CD1C Peptide - middle region

Product Specifications

Product Name Alternative

R7, CD1, CD1A, BDCA1

UniProt

P29017

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001756.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse EIF2S3X siRNA
abx915157-01 15 nmol

Mouse EIF2S3X siRNA

Sign In for Pricing
View Details
Mouse EIF2S3X siRNA
abx915157-02 30 nmol

Mouse EIF2S3X siRNA

Sign In for Pricing
View Details
Recombinant Human F13A1 Protein, N-His
orb2836863-01 20 µg

Recombinant Human F13A1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human F13A1 Protein, N-His
orb2836863-02 50 µg

Recombinant Human F13A1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human F13A1 Protein, N-His
orb2836863-03 100 µg

Recombinant Human F13A1 Protein, N-His

Sign In for Pricing
View Details
Lentiviral mouse Kcnip3 shRNA (UAS) - Lentiviral mouse Kcnip3 shRNA (UAS, GFP) (100)
GTR15120561 1 Vial

Lentiviral mouse Kcnip3 shRNA (UAS) - Lentiviral mouse Kcnip3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details