Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBA6 (300-350) rabbit polyclonal antibody, Aff - Purified
AP08298PU-N 50 µg

UBA6 (300-350) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
ZSCAN5A sgRNA CRISPR Lentivector set (Human)
K2741401 3x 1.0 µg

ZSCAN5A sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Igfals Mouse shRNA Plasmid (Locus ID 16005)
TL501057 1 Kit

Igfals Mouse shRNA Plasmid (Locus ID 16005)

Sign In for Pricing
View Details
RPL27A Antibody
MBS9605160-01 0.1 mL

RPL27A Antibody

Sign In for Pricing
View Details
RPL27A Antibody
MBS9605160-02 0.2 mL

RPL27A Antibody

Sign In for Pricing
View Details
RPL27A Antibody
MBS9605160-03 5x 0.2 mL

RPL27A Antibody

Sign In for Pricing
View Details