TPO/Thrombopoietin, Human (CHO, His)
TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.
Product Specifications
Product Name Alternative
TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO
UNSPSC
12352202
Purity
95.0
Smiles
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Molecular Formula
7066 (Gene_ID) P40225-1 (S22-G353) (Accession)
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
043391-APC 200 µL
TSPYL5, CT (TSPYL5, KIAA1750, Testis-specific Y-encoded-like protein 5) (APC) discontinued
Sign In for Pricing
View Details 
K0269507 1.0 µg DNA
C9orf95 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 129022 50 µg
LBR (Lamin-B Receptor, Integral Nuclear Envelope Inner Membrane Protein, LMN2R)
Sign In for Pricing
View Details 
46587061 1.0 µg DNA
TGDS Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details