Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KIF2C Antibody (KIF2C/6526) [DyLight 680]
NBP3-21102FR 0.1 mL

Mouse Monoclonal KIF2C Antibody (KIF2C/6526) [DyLight 680]

Sign In for Pricing
View Details
VCP Rabbit Polyclonal Antibody
TA890028S 30 µL

VCP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
JAK1 Antibody
AF6701-01 100 µL

JAK1 Antibody

Sign In for Pricing
View Details
JAK1 Antibody
AF6701-02 200 µL

JAK1 Antibody

Sign In for Pricing
View Details
EPO Rabbit Polyclonal Antibody
TA332825 100 µL

EPO Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CBX5 Protein, N-His-SUMO
YHE45601 100 μg

Recombinant Human CBX5 Protein, N-His-SUMO

Sign In for Pricing
View Details