TPO/Thrombopoietin, Human (CHO, His)
TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.
Product Specifications
Product Name Alternative
TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO
UNSPSC
12352202
Purity
95.0
Smiles
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Molecular Formula
7066 (Gene_ID) P40225-1 (S22-G353) (Accession)
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
035505-AP 200 µL
FANCA, ID (FANCA, FAA, FACA, FANCH, Fanconi anemia group A protein) (AP) discontinued
Sign In for Pricing
View Details 
MBS6200147-01 0.1 mL
CITED1 (CBP/p300 Interacting Transactivator 1, Cbp/p300-interacting Transactivator with Glu/Asp-rich Carboxy-terminal Domain 1, Melanocyte-specific Protein1) (MaxLight 490)
Sign In for Pricing
View Details 
MBS6200147-02 5x 0.1 mL
CITED1 (CBP/p300 Interacting Transactivator 1, Cbp/p300-interacting Transactivator with Glu/Asp-rich Carboxy-terminal Domain 1, Melanocyte-specific Protein1) (MaxLight 490)
Sign In for Pricing
View Details MBS095853-01 48 Well
Camel Retinoblastoma Tumor Suppressor Protein ELISA Kit
Sign In for Pricing
View Details MBS095853-02 96 Well
Camel Retinoblastoma Tumor Suppressor Protein ELISA Kit
Sign In for Pricing
View Details