Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP6C (NM_001123355) Human Over-expression Lysate
LS005537-100ug 100 µg

PPP6C (NM_001123355) Human Over-expression Lysate

Sign In for Pricing
View Details
PMP22 Human qPCR Template Standard (NM_153322)
HK205701 1 Kit

PMP22 Human qPCR Template Standard (NM_153322)

Sign In for Pricing
View Details
Human CA19-9 (CarbohydRate antigen19-9) QuickTest ELISA Kit
QT-EH0363 96 Tests

Human CA19-9 (CarbohydRate antigen19-9) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human Stress-induced-phosphoprotein 1 (STIP1) ELISA Kit
KTE60387-01 48 Tests

Human Stress-induced-phosphoprotein 1 (STIP1) ELISA Kit

Sign In for Pricing
View Details
Human Stress-induced-phosphoprotein 1 (STIP1) ELISA Kit
KTE60387-02 96 Tests

Human Stress-induced-phosphoprotein 1 (STIP1) ELISA Kit

Sign In for Pricing
View Details
Human Stress-induced-phosphoprotein 1 (STIP1) ELISA Kit
KTE60387-03 5x 96 Tests

Human Stress-induced-phosphoprotein 1 (STIP1) ELISA Kit

Sign In for Pricing
View Details