TPO/Thrombopoietin, Human (CHO, His)
TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.
Product Specifications
Product Name Alternative
TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO
UNSPSC
12352202
Purity
95.0
Smiles
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Molecular Formula
7066 (Gene_ID) P40225-1 (S22-G353) (Accession)
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-CTXII-Ra-48Tests 48 Tests
Rat Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit
Sign In for Pricing
View Details ELI-33804m 96 Tests
Mouse C-type lectin domain family 9 member A, Clec9a ELISA KIT
Sign In for Pricing
View Details PH33761M5 20 µg
Neurofilament (NEFM) (NM_005382) Human Recombinant Protein
Sign In for Pricing
View Details 49244141 1x 10^6 Cells / 1.0 mL
UQCRQ CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details