Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FE65 Antibody [DyLight 488]
NB110-58360G 0.1 mL

Rabbit Polyclonal FE65 Antibody [DyLight 488]

Sign In for Pricing
View Details
BAG6 Peptide - C-terminal region
MBS3240198-01 0.1 mg

BAG6 Peptide - C-terminal region

Sign In for Pricing
View Details
BAG6 Peptide - C-terminal region
MBS3240198-02 5x 0.1 mg

BAG6 Peptide - C-terminal region

Sign In for Pricing
View Details
ERAS 3'UTR GFP Stable Cell Line
TU056993 1.0 mL

ERAS 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
REEP5 Protein Vector (Mouse) (pPB-N-His)
PV223379 500 ng

REEP5 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Gm6904 3'UTR Luciferase Stable Cell Line
TU108502 1.0 mL

Gm6904 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details