Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPIC Blocking Peptide
MBS9623528-01 1 mg

SPIC Blocking Peptide

Sign In for Pricing
View Details
SPIC Blocking Peptide
MBS9623528-02 5x 1 mg

SPIC Blocking Peptide

Sign In for Pricing
View Details
ACE (Angiotensin I Converting Enzyme) BioAssayTM ELISA Kit (Rat) discontinued
381790 96 Tests

ACE (Angiotensin I Converting Enzyme) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Andarine (GTX-007) 25mg
A10076-25 25 mg

Andarine (GTX-007) 25mg

Sign In for Pricing
View Details
REEP6 siRNA (Rat)
MBS8220177-01 15 nmol

REEP6 siRNA (Rat)

Sign In for Pricing
View Details
REEP6 siRNA (Rat)
MBS8220177-02 30 nmol

REEP6 siRNA (Rat)

Sign In for Pricing
View Details