Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOT1 Protein Vector (Human) (pPB-C-His)
PV048533 500 ng

ACOT1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
E3 ligase Ligand 47
MF-0113219-01 10 mg

E3 ligase Ligand 47

Sign In for Pricing
View Details
E3 ligase Ligand 47
MF-0113219-02 50 mg

E3 ligase Ligand 47

Sign In for Pricing
View Details
OmniPAGE WAVE Maxi Comb, 30 sample, 2mm thick
VS20-30-2 1 Each

OmniPAGE WAVE Maxi Comb, 30 sample, 2mm thick

Sign In for Pricing
View Details
BAALC Lentiviral Activation Particles (m)
sc-431199-LAC 200 µL

BAALC Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
AIFM2 Recombinant Protein (Mouse)
RP115034 100 µg

AIFM2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details