TPO/Thrombopoietin, Human (CHO, His)
TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.
Product Specifications
Product Name Alternative
TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO
UNSPSC
12352202
Purity
95.0
Smiles
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Molecular Formula
7066 (Gene_ID) P40225-1 (S22-G353) (Accession)
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
Z06219-100 100 µg
Integrin alpha 1 beta 1 (ITGA1&ITGB1) Heterodimer, His, Mouse
Sign In for Pricing
View Details 
HA750767 100 µL
Cre recombinase Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
MBS6275719-01 0.1 mL
ASPHD2, ID (ASPHD2, Aspartate beta-hydroxylase domain-containing protein 2) (MaxLight 750)
Sign In for Pricing
View Details MBS6275719-02 5x 0.1 mL
ASPHD2, ID (ASPHD2, Aspartate beta-hydroxylase domain-containing protein 2) (MaxLight 750)
Sign In for Pricing
View Details