Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His)

TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Purity

95.0

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrps34 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6313106 1.0 µg DNA

Mrps34 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human PTD (Pentosidine) ELISA Kit
EKF57699 96 Tests

Human PTD (Pentosidine) ELISA Kit

Sign In for Pricing
View Details
METTL25B (NM_015997) Human Over-expression Lysate
LC414258 20 µg

METTL25B (NM_015997) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Caytaxin (ATCAY) ELISA Kit
MBS7245826-01 48 Well

Mouse Caytaxin (ATCAY) ELISA Kit

Sign In for Pricing
View Details
Mouse Caytaxin (ATCAY) ELISA Kit
MBS7245826-02 96 Well

Mouse Caytaxin (ATCAY) ELISA Kit

Sign In for Pricing
View Details
Mouse Caytaxin (ATCAY) ELISA Kit
MBS7245826-03 5x 96 Well

Mouse Caytaxin (ATCAY) ELISA Kit

Sign In for Pricing
View Details