TPO/Thrombopoietin, Human (CHO, His)
TPO/Thrombopoietin Protein, Human (CHO, His), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.
Product Specifications
Product Name Alternative
TPO/Thrombopoietin Protein, Human (CHO, His), Human, CHO
UNSPSC
12352202
Purity
95.0
Smiles
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Molecular Formula
7066 (Gene_ID) P40225-1 (S22-G353) (Accession)
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC214226 10 µg
Neurotrophin 3 (NTF3) (NM_002527) Human Tagged ORF Clone
Sign In for Pricing
View Details 
![Rabbit Monoclonal FABP1/L-FABP Antibody (FABP1/9085R) [DyLight 594]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP3-24046DL594 0.1 mL
Rabbit Monoclonal FABP1/L-FABP Antibody (FABP1/9085R) [DyLight 594]
Sign In for Pricing
View Details