Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLPI, Human (sf9, His)

The SLPI protein is an acid-stable protease inhibitor that has shown strong affinity for trypsin, chymotrypsin, elastase, and cathepsin G in multiple studies. It plays a critical regulatory role in inflammatory and immune responses following bacterial infection and Listeria monocytogenes infection. SLPI Protein, Human (sf9, His) is the recombinant human-derived SLPI protein, expressed by sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLPI Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slpi-protein-human-107a-a-sf9-his.html

Purity

97.0

Smiles

SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

Molecular Formula

6590 (Gene_ID) P03973 (S26-A132) (Accession)

Molecular Weight

Approximately 16-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-4727-3p miRNA Antagomir
abx886828-01 10 nmol

Human hsa-miR-4727-3p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-4727-3p miRNA Antagomir
abx886828-02 20 nmol

Human hsa-miR-4727-3p miRNA Antagomir

Sign In for Pricing
View Details
SUPT16H Rabbit Polyclonal Antibody (FITC)
orb2128278 100 µL

SUPT16H Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
C9orf16 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-15316R-BF594 100 µL

C9orf16 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
CBP/p300-IN-19 hydrochloride
T63565-01 25 mg

CBP/p300-IN-19 hydrochloride

Sign In for Pricing
View Details
CBP/p300-IN-19 hydrochloride
T63565-02 50 mg

CBP/p300-IN-19 hydrochloride

Sign In for Pricing
View Details