Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT16H Rabbit Polyclonal Antibody (FITC)

SUPT16H Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDC68, SPT16, FACTP140, SPT16/CDC68

UniProt

Q9Y5B9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SUPT16H

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

120kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009123

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Influenza Parainfluenza Type-3 Protein, Untagged, E.coli-50ug
QP12961-50ug 50ug

Recombinant Influenza Parainfluenza Type-3 Protein, Untagged, E.coli-50ug

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093UG-01 25 µg

PE/Cyanine5 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]
E-AB-F1093UG-02 100 µg

PE/Cyanine5 Anti-Mouse CD71 Antibody[R17 217.1.3/TIB-219]

Sign In for Pricing
View Details
Lentiviral human CRNKL1 sgRNA gene knockout kit - Lentiviral human CRNKL1 sgRNA gene knockout kit (25)
GTR15401382 1 Vial

Lentiviral human CRNKL1 sgRNA gene knockout kit - Lentiviral human CRNKL1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
UBE2E1 CytoSection
TS414934P5 25 Slides

UBE2E1 CytoSection

Sign In for Pricing
View Details
RABIF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV681559 1.0 µg DNA

RABIF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details