Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-C, Human (116a.a, HEK293)

VEGF-C Protein, Human (116a.a, HEK293) functions in lymphangiogenesis, where it acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth and migration.

Product Specifications

Product Name Alternative

VEGF-C Protein, Human (116a.a, HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf-c-protein-human-116a-a-hek293.html

Purity

95.00

Smiles

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Molecular Formula

7424 (Gene_ID) P49767 (A112-R227) (Accession)

Molecular Weight

Approximately 16-19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Joukov V, et al. A novel vascular endothelial growth factor, VEGF-C, is a ligand for the Flt4 (VEGFR-3) and KDR (VEGFR-2) receptor tyrosine kinases. EMBO J. 1996 Jan 15;15 (2) :290-98.|[2]Tammela T, et al. Blocking VEGFR-3 suppresses angiogenic sprouting and vascular network formation Nature. 2008 Jul 31;454 (7204) :656-60.|[3]Le Bras B, et al. VEGF-C is a trophic factor for neural progenitors in the vertebrate embryonic brain. Nat Neurosci. 2006 Mar;9 (3) :340-8.|[4]Machnik A, et al. Macrophages regulate salt-dependent volume and blood pressure by a vascular endothelial growth factor-C-dependent buffering mechanism. Nat Med. 2009 May;15 (5) :545-52.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Fluoro-Afatinib
TRC-A355395-250MG 250 mg

3-Fluoro-Afatinib

Sign In for Pricing
View Details
Fmoc-D-Ala-OH
GM6660-25g 25 g

Fmoc-D-Ala-OH

Sign In for Pricing
View Details
Fam195a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3441306 1.0 µg DNA

Fam195a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
MID1IP1 (NM_001098790) Human Over-expression Lysate
LC420677 20 µg

MID1IP1 (NM_001098790) Human Over-expression Lysate

Sign In for Pricing
View Details
FK 453
HY-105275A-01 1 mg

FK 453

Sign In for Pricing
View Details
FK 453
HY-105275A-02 5 mg

FK 453

Sign In for Pricing
View Details