Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 19 (TRBV19)

Recombinant Human T cell receptor beta variable 19 (TRBV19) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: T cell receptor beta variable 19 (TRBV19) . Accession Number: A0A075B6N1; TRBV19. Expression Region: 22-114aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 16.7kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human T cell receptor beta variable 19 (TRBV19) is a purified Recombinant Protein.

Accession Number

A0A075B6N1; TRBV19

Expression Region

22-114aa

Host

E. coli

Target

T cell receptor beta variable 19 (TRBV19)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PP2A alpha (Ser307) Recombinant Antibody, Cy5.5 Conjugated
bsm-61107R-Cy5.5 100 µL

Phospho-PP2A alpha (Ser307) Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Capsule Filter, PES,0.45/0.2μm, Ster.Grade, Not Sterile,500cm2,1/4" Multi Step HB, None, Bag label
CSKPS0402SN054MBNN0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Capsule Filter, PES,0.45/0.2μm, Ster.Grade, Not Sterile,500cm2,1/4" Multi Step HB, None, Bag label

Sign In for Pricing
View Details
CHRNB3 Protein, Human, Recombinant (ECD, hFc Tag)
PH52091M4 100 µg

CHRNB3 Protein, Human, Recombinant (ECD, hFc Tag)

Sign In for Pricing
View Details
Xpress™ Human KLK7 Over-expressing Stable Cell Line
ABC-X1651 1 Vial

Xpress™ Human KLK7 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
UBE2D4 CRISPRa sgRNA lentivector (set of three targets)(Rat)
48963126 3x 1.0µg DNA

UBE2D4 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Cyb5d2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4880402 1.0 µg DNA

Cyb5d2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details