Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Anoctamin-1 (ANO1), partial

Recombinant Human Anoctamin-1 (ANO1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Anoctamin-1 (ANO1) . Accession Number: Q5XXA6; ANO1. Expression Region: 806-892aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 17.6kda. Target Synonyms: Discovered on gastrointestinal stromal tumors protein 1; Oral cancer overexpressed protein 2; Transmembrane protein 16A; Tumor-amplified and overexpressed sequence 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Anoctamin-1 (ANO1), partial is a purified Recombinant Protein.

Accession Number

Q5XXA6; ANO1

Expression Region

806-892aa

Host

E. coli

Target

Anoctamin-1 (ANO1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Discovered on gastrointestinal stromal tumors protein 1; Oral cancer overexpressed protein 2; Transmembrane protein 16A; Tumor-amplified and overexpressed sequence 2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK 3 (E-3) : m-IgG Fc BP-HRP Bundle
sc-537940 1 Kit

ERK 3 (E-3) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
XAGE2 CRISPR Knock Out 293T Cell Line (Human)
50501141 1x 10^6 Cells / 1.0 mL

XAGE2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Mouse Cfap210 Pre-designed siRNA Set B
SI102433B 1 Each

Mouse Cfap210 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Superoxide Dismutase 1 (SOD1) Mouse Monoclonal Antibody [Clone ID: LBI8B10]
AMM09166V 100 µL

Superoxide Dismutase 1 (SOD1) Mouse Monoclonal Antibody [Clone ID: LBI8B10]

Sign In for Pricing
View Details
Cryzl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3501907 1.0 µg DNA

Cryzl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Camel Leptin ELISA Kit
MBS091173-01 48 Well

Camel Leptin ELISA Kit

Sign In for Pricing
View Details