Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Telomerase protein component 1 (TEP1), partial

Recombinant Human Telomerase protein component 1 (TEP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Telomerase protein component 1 (TEP1) . Accession Number: Q99973; TEP1. Expression Region: 2-226aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 28.8kda. Target Synonyms: Telomerase-associated protein 1; Telomerase protein 1p240p80 telomerase homolog Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Telomerase protein component 1 (TEP1), partial is a purified Recombinant Protein.

Accession Number

Q99973; TEP1

Expression Region

2-226aa

Host

E. coli

Target

Telomerase protein component 1 (TEP1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Telomerase-associated protein 1; Telomerase protein 1p240p80 telomerase homolog

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

EKLHGHVSAHPDILSLENRCLAMLPDLQPLEKLHQHVSTHSDILSLKNQCLATLPDLKTMEKPHGYVSAHPDILSLENQCLATLSDLKTMEKPHGHVSAHPDILSLENRCLATLSSLKSTVSASPLFQSLQISHMTQADLYRVNNSNCLLSEPPSWRAQHFSKGLDLSTCPIALKSISATETAQEATLGRWFDSEEKKGAETQMPSYSLSLGEEEEVEDLAVKLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd3e Hamster Monoclonal Antibody [Clone ID: 145-2C11]
AM12132PU-N 100 µg

Cd3e Hamster Monoclonal Antibody [Clone ID: 145-2C11]

Sign In for Pricing
View Details
Tissue Total RNA, Colon: rectosigmoid
CR561886 5 µg

Tissue Total RNA, Colon: rectosigmoid

Sign In for Pricing
View Details
Tmem89 Mouse Gene Knockout Kit (CRISPR)
KN517911 1 Kit

Tmem89 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FASTK (C-term) Rabbit Polyclonal Antibody
AP13667PU-N 400 µL

FASTK (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATP citrate lyase Recombinant Rabbit monoclonal Antibody
HA750171 100 µL

ATP citrate lyase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
T7 tag Mouse Monoclonal Antibody [4-C2]
EM50802 100 µL

T7 tag Mouse Monoclonal Antibody [4-C2]

Sign In for Pricing
View Details