Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Insulin-like growth factor I (Igf1)

Recombinant Rat Insulin-like growth factor I (Igf1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Insulin-like growth factor I (Igf1) . Accession Number: P08025; Igf1. Expression Region: 49-118aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 34.7kda. Target Synonyms: Somatomedin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Insulin-like growth factor I (Igf1) is a purified Recombinant Protein.

Accession Number

P08025; Igf1

Expression Region

49-118aa

Host

E. coli

Target

Insulin-like growth factor I (Igf1)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Somatomedin

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EF-CAB2 shRNA (m) Lentiviral Particles
sc-143301-V 200 µL

EF-CAB2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
CREB (Phospho-Ser121) Colorimetric Cell-Based ELISA Kit
EKC2064 1 Kit, Containing two 96 Well Plates and all necessary reagents

CREB (Phospho-Ser121) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
LILRB2 Antibody
orb2683558-01 50 µL

LILRB2 Antibody

Sign In for Pricing
View Details
LILRB2 Antibody
orb2683558-02 100 µL

LILRB2 Antibody

Sign In for Pricing
View Details
LILRB2 Antibody
orb2683558-03 200 µL

LILRB2 Antibody

Sign In for Pricing
View Details
Porcine CD30 (Cluster of Differentiation 30) ELISA Kit
MBS2503339-01 24 Tests

Porcine CD30 (Cluster of Differentiation 30) ELISA Kit

Sign In for Pricing
View Details