Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-12 (RAB12)

Recombinant Human Ras-related protein Rab-12 (RAB12) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Ras-related protein Rab-12 (RAB12) . Accession Number: Q6IQ22; RAB12. Expression Region: 1-244aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 34.7kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Ras-related protein Rab-12 (RAB12) is a purified Recombinant Protein.

Accession Number

Q6IQ22; RAB12

Expression Region

1-244aa

Host

E. coli

Target

Ras-related protein Rab-12 (RAB12)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1E1 Human Pre-designed siRNA Set A
HY-RS01229 1 Set

ATP6V1E1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Equine IgG, Fc Specific
AAF-432-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Equine IgG, Fc Specific

Sign In for Pricing
View Details
Anti-Neisseria gonorrhoeae Mouse Monoclonal Antibody - Library Pack
158101-1 4x 100 µg

Anti-Neisseria gonorrhoeae Mouse Monoclonal Antibody - Library Pack

Sign In for Pricing
View Details
Polytetramethylene Ether Glycol
OR1014799-01 25 g

Polytetramethylene Ether Glycol

Sign In for Pricing
View Details
Polytetramethylene Ether Glycol
OR1014799-02 100 g

Polytetramethylene Ether Glycol

Sign In for Pricing
View Details
Polytetramethylene Ether Glycol
OR1014799-03 500 g

Polytetramethylene Ether Glycol

Sign In for Pricing
View Details