Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Hyaluronan and proteoglycan link protein 1 (HAPLN1) . Accession Number: P10915; HAPLN1. Expression Region: 16-354aa. Tag Info: Tag-Free. Theoretical MW: 38.6kda. Target Synonyms: Cartilage-linking protein 1; Cartilage-link protein; Proteoglycan link protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein.

Accession Number

P10915; HAPLN1

Expression Region

16-354aa

Host

E. coli

Target

Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cartilage-linking protein 1; Cartilage-link protein; Proteoglycan link protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR37 Antibody
A72560-100UG 100 µg

WDR37 Antibody

Sign In for Pricing
View Details
SH2B2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2138505 3x 1.0 µg

SH2B2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MARK4 (NM_031417) Human Tagged ORF Clone Lentiviral Particle
RC222580L2V 200 µL

MARK4 (NM_031417) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
In vivo Grade Recombinant HyHEL-10 Rabbit IgG Isotype Control Antibody
YR0233 5 mg

In vivo Grade Recombinant HyHEL-10 Rabbit IgG Isotype Control Antibody

Sign In for Pricing
View Details
Human Ribonuclease T2 (RNASET2) ELISA Kit
RK11830 96 Tests

Human Ribonuclease T2 (RNASET2) ELISA Kit

Sign In for Pricing
View Details
Sphingomyelin Synthase 2 (aa 1-79) Human Recombinant
B2017564 50 µg

Sphingomyelin Synthase 2 (aa 1-79) Human Recombinant

Sign In for Pricing
View Details