Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Fibroblast growth factor 2 (FGF2)

Recombinant Chicken Fibroblast growth factor 2 (FGF2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chicken (Gallus) . Target Name: Fibroblast growth factor 2 (FGF2) . Accession Number: P48800; FGF2. Expression Region: 13-158aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 23.8kda. Target Synonyms: FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Chicken Fibroblast growth factor 2 (FGF2) is a purified Recombinant Protein.

Accession Number

P48800; FGF2

Expression Region

13-158aa

Host

E. coli

Target

Fibroblast growth factor 2 (FGF2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Species

Chicken (Gallus)

Protein Name

Recombinant Protein

AA Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Rheumatoid Factor IgA ELISA kit
GTR10384441 96 Well

Rabbit Rheumatoid Factor IgA ELISA kit

Sign In for Pricing
View Details
PYHIN1, Human (His, Strep, Flag)
HY-P701995 1 Each

PYHIN1, Human (His, Strep, Flag)

Sign In for Pricing
View Details
LINGO3, CT (LINGO3, LERN2, LRRN6B, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3, Leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 6B) (Azide free) (HRP) discontinued
037810-HRP 200 µL

LINGO3, CT (LINGO3, LERN2, LRRN6B, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3, Leucine-rich repeat neuronal protein 2, Leucine-rich repeat neuronal protein 6B) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
NTAL (6D620)
sc-71729 100 µg/mL

NTAL (6D620)

Sign In for Pricing
View Details
PRPF6 Rabbit Polyclonal Antibody (Biotin)
orb2124985 100 µL

PRPF6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rat Ubiquitin Carboxyl-Terminal Hydrolase 21 (USP21) ELISA Kit
abx552299 96 Tests

Rat Ubiquitin Carboxyl-Terminal Hydrolase 21 (USP21) ELISA Kit

Sign In for Pricing
View Details