Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF6 Rabbit Polyclonal Antibody (Biotin)

PRPF6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TOM, ANT1, Prp6, RP60, ANT-1, hPrp6, U5-102K, C20orf14, SNRNP102

UniProt

O94906

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PRPF6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Rat 3-Nitrotyrosine (3-NT)
KTE100307-01 48 Tests

ELISA kit for Rat 3-Nitrotyrosine (3-NT)

Sign In for Pricing
View Details
ELISA kit for Rat 3-Nitrotyrosine (3-NT)
KTE100307-02 96 Tests

ELISA kit for Rat 3-Nitrotyrosine (3-NT)

Sign In for Pricing
View Details
ELISA kit for Rat 3-Nitrotyrosine (3-NT)
KTE100307-03 5x 96 Well

ELISA kit for Rat 3-Nitrotyrosine (3-NT)

Sign In for Pricing
View Details
EG621697 shRNA (m) Lentiviral Particles
sc-143812-V 200 µL

EG621697 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Human BLIMP1/PRDM1 (NP_001189.2) VersaClone cDNA
RDC3480 10 µg

Human BLIMP1/PRDM1 (NP_001189.2) VersaClone cDNA

Sign In for Pricing
View Details
D9 THC (D9-THC-COOH) (HRP) discontinued
226907 500 µL

D9 THC (D9-THC-COOH) (HRP) discontinued

Sign In for Pricing
View Details