Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Rhodopsin (RHO)

Recombinant Bovine Rhodopsin (RHO) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus) . Target Name: Rhodopsin (RHO) . Accession Number: P02699; RHO. Expression Region: 1-348aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 45.0kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bovine Rhodopsin (RHO) is a purified CF Transmembrane Protein.

Accession Number

P02699; RHO

Expression Region

1-348aa

Host

E. coli

Target

Rhodopsin (RHO)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

45.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Bovine (Bos taurus)

Protein Name

CF Transmembrane Protein

AA Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Kallikrein 7/KLK7 Protein (His Tag)
PKSH033421-01 10 µg

Recombinant Human Kallikrein 7/KLK7 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Kallikrein 7/KLK7 Protein (His Tag)
PKSH033421-02 50 µg

Recombinant Human Kallikrein 7/KLK7 Protein (His Tag)

Sign In for Pricing
View Details
CHRNA5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H10]
TA810073BM 100 µL

CHRNA5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H10]

Sign In for Pricing
View Details
EGFR pTyr1197 Rabbit Polyclonal Antibody
AP02486PU-S 50 µL

EGFR pTyr1197 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GSH (Glutathione) ELISA Kit
E-EL-0026-01 24 Tests

GSH (Glutathione) ELISA Kit

Sign In for Pricing
View Details
GSH (Glutathione) ELISA Kit
E-EL-0026-02 48 Tests

GSH (Glutathione) ELISA Kit

Sign In for Pricing
View Details