Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-X-C motif chemokine 13 protein (CXCL13) . Accession Number: O43927; CXCL13; BCA1; BLC; SCYB13. Expression Region: 23-109aa. Tag Info: Tag-Free. Theoretical MW: 10.3kda. Target Synonyms: Angie; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein is a purified Active Recombinant Protein.

Accession Number

O43927; CXCL13; BCA1; BLC; SCYB13

Expression Region

23-109aa

Host

E. coli

Target

C-X-C motif chemokine 13 protein (CXCL13)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Angie; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Histone H4 (pS47) Antibody
YLD4007-01 50 µL

Rabbit anti-Histone H4 (pS47) Antibody

Sign In for Pricing
View Details
Rabbit anti-Histone H4 (pS47) Antibody
YLD4007-02 100 µL

Rabbit anti-Histone H4 (pS47) Antibody

Sign In for Pricing
View Details
BIRC2 Rabbit Monoclonal Antibody
E49Y6913 100 µL

BIRC2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MEX3A Antibody
NBP2-57357 100 µL

Rabbit Polyclonal MEX3A Antibody

Sign In for Pricing
View Details
HDAC7 Polyclonal Antibody
MBS9402544-01 0.05 mL

HDAC7 Polyclonal Antibody

Sign In for Pricing
View Details
HDAC7 Polyclonal Antibody
MBS9402544-02 0.1 mL

HDAC7 Polyclonal Antibody

Sign In for Pricing
View Details