Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-X-C motif chemokine 13 protein (CXCL13) . Accession Number: O43927; CXCL13; BCA1; BLC; SCYB13. Expression Region: 23-109aa. Tag Info: Tag-Free. Theoretical MW: 10.3kda. Target Synonyms: Angie; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein is a purified Active Recombinant Protein.

Accession Number

O43927; CXCL13; BCA1; BLC; SCYB13

Expression Region

23-109aa

Host

E. coli

Target

C-X-C motif chemokine 13 protein (CXCL13)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Angie; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK4 antibody
10R-2374 50 ug

CDK4 antibody

Sign In for Pricing
View Details
PARD6A discontinued
392762 200 µL

PARD6A discontinued

Sign In for Pricing
View Details
9230110C19Rik (NM_199017) Mouse Untagged Clone
MC212998 10 µg

9230110C19Rik (NM_199017) Mouse Untagged Clone

Sign In for Pricing
View Details
Anti-ADCY 1 (230-280) Antibody
B2020726 100 µL

Anti-ADCY 1 (230-280) Antibody

Sign In for Pricing
View Details
PRPH discontinued
393401 200 µL

PRPH discontinued

Sign In for Pricing
View Details
Mouse Anti-Human IgG Fc Antibody (AF790)
abx142871-01 100 µL

Mouse Anti-Human IgG Fc Antibody (AF790)

Sign In for Pricing
View Details