Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHBP, Human (HEK293, His)

CRHBP Protein critically regulates by binding to and inactivating corticotropin-releasing factor (CRF), suggesting a role in preventing excessive pituitary-adrenal stimulation, especially during pregnancy. This interaction contributes to balancing neuroendocrine signaling pathways, ensuring appropriate physiological responses and safeguarding against pituitary-adrenal axis overstimulation, particularly in the context of pregnancy. CRHBP Protein, Human (HEK293, His) is the recombinant human-derived CRHBP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRHBP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crhbp-protein-human-hek-293-his.html

Purity

98.5

Smiles

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Molecular Formula

1393 (Gene_ID) P24387 (Y25-L322) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horizontal Autoclave
LX282HA 1 Unit

Horizontal Autoclave

Sign In for Pricing
View Details
Mouse Interleukin 1 Beta (IL1b) ELISA Kit
RD-IL1b-Mu-96Tests 96 Tests

Mouse Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Myo5b 3'UTR GFP Stable Cell Line
TU163745 1.0 mL

Myo5b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RGS1 (Regulator of G-Protein Signaling 1, RGS-1, 1R20, B Cell Activation Protein BL34, BL34, Early Response Protein 1R20, IER1, IR20) (MaxLight 550)
132521-ML550 100 µL

RGS1 (Regulator of G-Protein Signaling 1, RGS-1, 1R20, B Cell Activation Protein BL34, BL34, Early Response Protein 1R20, IER1, IR20) (MaxLight 550)

Sign In for Pricing
View Details
1, 4-PREGNADIEN-6α-METHYL-17, 21-DIOL-3, 11, 20-TRIONE
503775 Inquire

1, 4-PREGNADIEN-6α-METHYL-17, 21-DIOL-3, 11, 20-TRIONE

Sign In for Pricing
View Details
OLIG1 (Oligodendrocyte Transcription Factor 1, Oligo1, Class B Basic Helix-loop-helix Protein 6, bHLHb6, Class E Basic Helix-loop-helix Protein 21, bHLHe21, BHLHB6, BHLHE21) (MaxLight 750) discontinued
130708-ML750 100 µL

OLIG1 (Oligodendrocyte Transcription Factor 1, Oligo1, Class B Basic Helix-loop-helix Protein 6, bHLHb6, Class E Basic Helix-loop-helix Protein 21, bHLHe21, BHLHB6, BHLHE21) (MaxLight 750) discontinued

Sign In for Pricing
View Details