Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHBP, Human (HEK293, His)

CRHBP Protein critically regulates by binding to and inactivating corticotropin-releasing factor (CRF), suggesting a role in preventing excessive pituitary-adrenal stimulation, especially during pregnancy. This interaction contributes to balancing neuroendocrine signaling pathways, ensuring appropriate physiological responses and safeguarding against pituitary-adrenal axis overstimulation, particularly in the context of pregnancy. CRHBP Protein, Human (HEK293, His) is the recombinant human-derived CRHBP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRHBP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crhbp-protein-human-hek-293-his.html

Purity

98.5

Smiles

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Molecular Formula

1393 (Gene_ID) P24387 (Y25-L322) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+)-Usniacin
MBS578903 Inquire

(+)-Usniacin

Sign In for Pricing
View Details
PRMT4 Chemiluminescent Assay Kit
52041L 96 Reactions

PRMT4 Chemiluminescent Assay Kit

Sign In for Pricing
View Details
Macroh2a1 (NM_012015) Mouse Tagged ORF Clone
MG222124 10 µg

Macroh2a1 (NM_012015) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
POT1 Peptide - C-terminal region
MBS3244419-01 0.1 mg

POT1 Peptide - C-terminal region

Sign In for Pricing
View Details
POT1 Peptide - C-terminal region
MBS3244419-02 5x 0.1 mg

POT1 Peptide - C-terminal region

Sign In for Pricing
View Details
MEKK1, CT (MAPK/ERK Kinase Kinase 1, MEK Kinase 1, MEKK 1, MEKK1, MEKK, Mitogen-activated Protein Kinase Kinase Kinase 1, MAP3K1, MAPKKK1, SRXY6) (MaxLight 490) discontinued
M2867-01C-ML490 100 µL

MEKK1, CT (MAPK/ERK Kinase Kinase 1, MEK Kinase 1, MEKK 1, MEKK1, MEKK, Mitogen-activated Protein Kinase Kinase Kinase 1, MAP3K1, MAPKKK1, SRXY6) (MaxLight 490) discontinued

Sign In for Pricing
View Details