Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHBP, Human (HEK293, His)

CRHBP Protein critically regulates by binding to and inactivating corticotropin-releasing factor (CRF), suggesting a role in preventing excessive pituitary-adrenal stimulation, especially during pregnancy. This interaction contributes to balancing neuroendocrine signaling pathways, ensuring appropriate physiological responses and safeguarding against pituitary-adrenal axis overstimulation, particularly in the context of pregnancy. CRHBP Protein, Human (HEK293, His) is the recombinant human-derived CRHBP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRHBP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crhbp-protein-human-hek-293-his.html

Purity

98.5

Smiles

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Molecular Formula

1393 (Gene_ID) P24387 (Y25-L322) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lenti-ORF, TXNRD1 (Myc-DDK-tagged)-Human thioredoxin reductase 1 (TXNRD1), transcript variant 4, (Note, selenocystein protein, internal stop codo
RC216263L3 10 µg

Lenti-ORF, TXNRD1 (Myc-DDK-tagged)-Human thioredoxin reductase 1 (TXNRD1), transcript variant 4, (Note, selenocystein protein, internal stop codo

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1 (L18F, D614G) (His Tag)
PKSV030399 100 µg

Recombinant SARS-CoV-2 Spike S1 (L18F, D614G) (His Tag)

Sign In for Pricing
View Details
RAD51-IN-5
MF-0153482-01 25 mg

RAD51-IN-5

Sign In for Pricing
View Details
RAD51-IN-5
MF-0153482-02 50 mg

RAD51-IN-5

Sign In for Pricing
View Details
Human Protein SPACA7, C13orf28 ELISA Kit
MBS9318439-01 48 Well

Human Protein SPACA7, C13orf28 ELISA Kit

Sign In for Pricing
View Details
Human Protein SPACA7, C13orf28 ELISA Kit
MBS9318439-02 96 Well

Human Protein SPACA7, C13orf28 ELISA Kit

Sign In for Pricing
View Details