Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHBP, Human (HEK293, His)

CRHBP Protein critically regulates by binding to and inactivating corticotropin-releasing factor (CRF), suggesting a role in preventing excessive pituitary-adrenal stimulation, especially during pregnancy. This interaction contributes to balancing neuroendocrine signaling pathways, ensuring appropriate physiological responses and safeguarding against pituitary-adrenal axis overstimulation, particularly in the context of pregnancy. CRHBP Protein, Human (HEK293, His) is the recombinant human-derived CRHBP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRHBP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crhbp-protein-human-hek-293-his.html

Purity

98.5

Smiles

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Molecular Formula

1393 (Gene_ID) P24387 (Y25-L322) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

N4BP2L2 Rabbit Polyclonal Antibody
TA315055 100 µL

N4BP2L2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ErbB4, CT (Receptor Tyrosine-protein Kinase erbB-4, Proto-oncogene-like Protein c-ErbB-4, p180erbB4, Tyrosine Kinase-type Cell Surface Receptor HER4, ERBB4)
E3451-41S 200 µL

ErbB4, CT (Receptor Tyrosine-protein Kinase erbB-4, Proto-oncogene-like Protein c-ErbB-4, p180erbB4, Tyrosine Kinase-type Cell Surface Receptor HER4, ERBB4)

Sign In for Pricing
View Details
1- (4-Bromophenylsulfonyl) -4-methylpiperazine
408048-01 100 mg

1- (4-Bromophenylsulfonyl) -4-methylpiperazine

Sign In for Pricing
View Details
1- (4-Bromophenylsulfonyl) -4-methylpiperazine
408048-02 250 mg

1- (4-Bromophenylsulfonyl) -4-methylpiperazine

Sign In for Pricing
View Details
Mouse Monoclonal Survivin Antibody (60.11) [Allophycocyanin]
NB500-238APC 0.1 mL

Mouse Monoclonal Survivin Antibody (60.11) [Allophycocyanin]

Sign In for Pricing
View Details
FOXP3 (Forkhead Box Protein P3, Scurfin, IPEX, JM2, MGC141961, MGC141963, PIDX, XPID)
140355 200 µL

FOXP3 (Forkhead Box Protein P3, Scurfin, IPEX, JM2, MGC141961, MGC141963, PIDX, XPID)

Sign In for Pricing
View Details