Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF165, Human (HEK293)

VEGF165 Protein, Human is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF165 Protein is the growth factor that affects the angiogenesis, vasculogenesis and endothelial cell growth. VEGF165 Protein can binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin, and affects the motor neuron signaling pathway. VEGF165 Protein, Human (HEK293) is a human-derived VEGF165 Protein that can be expressed by HEK293.

Product Specifications

Product Name Alternative

VEGF165 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf165-protein-human-206a-a-hek293.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-4 (A27-R191) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25 (1) :1-19.|[2]Dan H, et al., CM082, a novel VEGF receptor tyrosine kinase inhibitor, can inhibit angiogenesis in vitro and in vivo. Microvasc Res. 2021 Jul;136:104146.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Tetraspanin-4 (TSPAN4)
orb2917388-01 20 µg

Recombinant Human Tetraspanin-4 (TSPAN4)

Sign In for Pricing
View Details
Recombinant Human Tetraspanin-4 (TSPAN4)
orb2917388-02 100 µg

Recombinant Human Tetraspanin-4 (TSPAN4)

Sign In for Pricing
View Details
PSMB3 sgRNA CRISPR Lentivector (Human) (Target 3)
K1739604 1.0 µg DNA

PSMB3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GATA2, CT
501705 200 µL

GATA2, CT

Sign In for Pricing
View Details
UHRF2 Antibody
CSB-PA839395LA01HU-01 50 µg

UHRF2 Antibody

Sign In for Pricing
View Details
UHRF2 Antibody
CSB-PA839395LA01HU-02 100 µg

UHRF2 Antibody

Sign In for Pricing
View Details