Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-4 (TSPAN4)

This Recombinant Human Tetraspanin-4 (TSPAN4) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Tetraspanin-4, Tspan-4, Novel antigen 2, NAG-2, Transmembrane 4 superfamily member 7

UniProt

O14817

Expression Region

1-238

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIIT GAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLK KGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLH APGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)
RPC30101-01 20 µg

Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)

Sign In for Pricing
View Details
Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)
RPC30101-02 100 µg

Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)

Sign In for Pricing
View Details
Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)
RPC30101-03 1 mg

Recombinant Human Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)

Sign In for Pricing
View Details
MFRP Polyclonal Antibody
MBS8531358-01 0.1 mg

MFRP Polyclonal Antibody

Sign In for Pricing
View Details
MFRP Polyclonal Antibody
MBS8531358-02 0.1 mL (AF635)

MFRP Polyclonal Antibody

Sign In for Pricing
View Details
MFRP Polyclonal Antibody
MBS8531358-03 0.1 mL (AF610)

MFRP Polyclonal Antibody

Sign In for Pricing
View Details