Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL-1 beta Recombinant Protein

The Mouse IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-1 beta Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152) ) (Gene ID: 16176) . For research use only.

Product Specifications

Background

IL-1 beta is produced by activated macrophages, monocytes, and a subset of dentritic cells. This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Mus musculus (house mouse)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

17.4 kDa

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Polyoxin D
HY-136461 1 Each

Polyoxin D

Ask
View Details
FIM1 siRNA Oligos set (Human)
57511171 3x 5 nmol

FIM1 siRNA Oligos set (Human)

Ask
View Details
Mouse Monoclonal HDAC7 Antibody (PCRP-HDAC7-1B6) [Janelia Fluor 669]
NBP3-26986JF669 0.1 mL

Mouse Monoclonal HDAC7 Antibody (PCRP-HDAC7-1B6) [Janelia Fluor 669]

Ask
View Details
DNASE2 (Deoxyribonuclease-2-alpha, Acid DNase, DNase II, R31240_2, Deoxyribonuclease II alpha, DNASE2A, DNL2)
MBS6007496-01 0.1 mg

DNASE2 (Deoxyribonuclease-2-alpha, Acid DNase, DNase II, R31240_2, Deoxyribonuclease II alpha, DNASE2A, DNL2)

Ask
View Details
DNASE2 (Deoxyribonuclease-2-alpha, Acid DNase, DNase II, R31240_2, Deoxyribonuclease II alpha, DNASE2A, DNL2)
MBS6007496-02 5x 0.1 mg

DNASE2 (Deoxyribonuclease-2-alpha, Acid DNase, DNase II, R31240_2, Deoxyribonuclease II alpha, DNASE2A, DNL2)

Ask
View Details
Recombinant Inosine Triphosphatase Pyrophosphatase (ITPA)
SIPC237Mu02-01 10 µg

Recombinant Inosine Triphosphatase Pyrophosphatase (ITPA)

Ask
View Details