Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Product Specifications

Abbreviation

Recombinant Bovine EGF protein, partial

Gene Name

EGF

UniProt

XP_024849546.1

Expression Region

990-1046aa

Organism

Bos taurus (Bovine)

Target Sequence

FPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIGYPGKRGEYIDFDGWDPHSAGRGH

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal transduction

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frizzled 6 (FZD6) (NM_001164615) Human Tagged ORF Clone Lentiviral Particle
RC229001L4V 200 µL

Frizzled 6 (FZD6) (NM_001164615) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Gamma-Glutamyltransferase 1 (GGT1) ELISA Kit
abx570455 96 Well

Mouse Gamma-Glutamyltransferase 1 (GGT1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human C15orf39 shRNA (UAS) - Lentiviral human C15orf39 shRNA (UAS) plasmid
GTR15307006 1 Vial

Lentiviral human C15orf39 shRNA (UAS) - Lentiviral human C15orf39 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Rod shape-determining protein mreD (mreD)
orb2920435-01 20 µg

Recombinant Haemophilus influenzae Rod shape-determining protein mreD (mreD)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Rod shape-determining protein mreD (mreD)
orb2920435-02 100 µg

Recombinant Haemophilus influenzae Rod shape-determining protein mreD (mreD)

Sign In for Pricing
View Details
Mouse NECAP1 siRNA
abx925682-01 15 nmol

Mouse NECAP1 siRNA

Sign In for Pricing
View Details