Recombinant Haemophilus influenzae Rod shape-determining protein mreD (mreD)
This Recombinant Haemophilus influenzae Rod shape-determining protein mreD (mreD) spans the amino acid sequence from region 1-162.
Product Specifications
Product Name Alternative
Rod shape-determining protein mreD
UniProt
P44476
Expression Region
1-162
Origin
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MQTRFILQWFTILSFFVIAFVLELAPWPVGFQMLKPAWLVLVLLYWVLAIPNKVSIGWSF LLGLTWDLILGSTLGVHALVLSTSMYIIAKNYLILRNLSLWFQSLLVVLFVFIIRLLIFL VEFSLHTAFFHWQAILGAFASGLLWPWVFLLMRKIRRKVKLH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-UNEL-H0054-01 5x 96 Tests
Uncoated Human GDF2 (Growth Differentiation Factor 2) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0054-02 15x 96 Tests
Uncoated Human GDF2 (Growth Differentiation Factor 2) ELISA Kit
Sign In for Pricing
View Details 
BNUB1878-100 1x 100 µL
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/1878R), 0.2mg/mL
Sign In for Pricing
View Details