Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF3 Rabbit pAb (APR30432N)

Product Specifications

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its similarity with mouse fgf3/int-2, a proto-oncogene activated in virally induced mammary tumors in the mouse. Frequent amplification of this gene has been found in human tumors, which may be important for neoplastic transformation and tumor progression. Studies of the similar genes in mouse and chicken suggested the role in inner ear formation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FGF3 Rabbit pAb (APR23394N0) .

Synonyms

FGF3; HBGF-3; INT2

Gene ID

2248

UniProt

P11487

Applications

WB (Gallus gallus) IF (Gallus gallus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2248

Uniprot URL

https://www.uniprot.org/uniprot/P11487

AA Sequence

MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Inhibin beta C chain (Inhbc), partial
CSB-EP011721MO-01 20 µg

Recombinant Mouse Inhibin beta C chain (Inhbc), partial

Sign In for Pricing
View Details
Recombinant Mouse Inhibin beta C chain (Inhbc), partial
CSB-EP011721MO-02 100 µg

Recombinant Mouse Inhibin beta C chain (Inhbc), partial

Sign In for Pricing
View Details
Recombinant Mouse Inhibin beta C chain (Inhbc), partial
CSB-EP011721MO-03 1 mg

Recombinant Mouse Inhibin beta C chain (Inhbc), partial

Sign In for Pricing
View Details
Anti-Fos B antibody
STJ93103 200 µl

Anti-Fos B antibody

Sign In for Pricing
View Details
FOXG1, ID (FOXG1, FKH2, FKHL1, FKHL2, FKHL3, FKHL4, FOXG1A, FOXG1B, FOXG1C, Forkhead box protein G1, Brain factor 1, Brain factor 2, Forkhead box protein G1A, Forkhead box protein G1B, Forkhead box protein G1C, Forkhead-related protein FKHL1, Forkhead-related protein FKHL2, Forkhead-related protein FKHL3) (FITC) discontinued
035734-FITC 200 µL

FOXG1, ID (FOXG1, FKH2, FKHL1, FKHL2, FKHL3, FKHL4, FOXG1A, FOXG1B, FOXG1C, Forkhead box protein G1, Brain factor 1, Brain factor 2, Forkhead box protein G1A, Forkhead box protein G1B, Forkhead box protein G1C, Forkhead-related protein FKHL1, Forkhead-related protein FKHL2, Forkhead-related protein FKHL3) (FITC) discontinued

Sign In for Pricing
View Details
NSUN6 Antibody
OAAN02176-50UL 50 µL

NSUN6 Antibody

Sign In for Pricing
View Details