Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Inhibin beta C chain (Inhbc), partial

Product Specifications

Product Name Alternative

Activin beta-C chain

Abbreviation

Recombinant Mouse Inhbc protein, partial

Gene Name

Inhbc

UniProt

P55104

Expression Region

237-352aa

Organism

Mus musculus (Mouse)

Target Sequence

GIDCQGASRMCCRQEFFVDFREIGWNDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLNLLKANAAAGTTGRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active+pro Caspase 3 Rabbit Monoclonal Antibody
AF1675 50 µL

Active+pro Caspase 3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DRAM2 Human shRNA Lentiviral Particle (Locus ID 128338)
TL300945V 500 µL Each

DRAM2 Human shRNA Lentiviral Particle (Locus ID 128338)

Sign In for Pricing
View Details
MED23 Protein Vector (Human) (pPM-C-HA)
PV093724 500 ng

MED23 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Sialidase 3 (NEU3) Antibody (Biotin)
abx306589-01 20 µg

Sialidase 3 (NEU3) Antibody (Biotin)

Sign In for Pricing
View Details
Sialidase 3 (NEU3) Antibody (Biotin)
abx306589-02 50 µg

Sialidase 3 (NEU3) Antibody (Biotin)

Sign In for Pricing
View Details
Sialidase 3 (NEU3) Antibody (Biotin)
abx306589-03 100 µg

Sialidase 3 (NEU3) Antibody (Biotin)

Sign In for Pricing
View Details