Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEU1 Rabbit pAb (APR30071N)

Product Specifications

Background

The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein') . Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NEU1 Rabbit pAb (APR30071N) .

Synonyms

NEU1; NANH; NEU; SIAL1

Gene ID

4758

UniProt

Q99519

Cellular Locus

Cell membrane, Cytoplasmic vesicle, Lumenal side, Lysosome lumen, Lysosome membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa Observed MW: 45KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4758

Uniprot URL

https://www.uniprot.org/uniprot/Q99519

AA Sequence

SLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAP3 (Death Associated Protein 3, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29, bMRP-10) (HRP)
MBS6450798-01 0.1 mL

DAP3 (Death Associated Protein 3, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29, bMRP-10) (HRP)

Sign In for Pricing
View Details
DAP3 (Death Associated Protein 3, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29, bMRP-10) (HRP)
MBS6450798-02 5x 0.1 mL

DAP3 (Death Associated Protein 3, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29, bMRP-10) (HRP)

Sign In for Pricing
View Details
2xHieff™ PCR Master Mix (With Dye)
10102ES50 50x 1 mL

2xHieff™ PCR Master Mix (With Dye)

Sign In for Pricing
View Details
Mouse Monoclonal AKR7A3 Antibody (2E11) [DyLight 405]
NBP1-97944V 100 µL

Mouse Monoclonal AKR7A3 Antibody (2E11) [DyLight 405]

Sign In for Pricing
View Details
Human SF3B4 knockout cell line
ABC-KH13650 1 Vial

Human SF3B4 knockout cell line

Sign In for Pricing
View Details
MY-5445 100mg
A20349-100 100 mg

MY-5445 100mg

Sign In for Pricing
View Details