Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF7 Rabbit pAb (APR29921N)

Product Specifications

Background

SLAM family member 7 (SLAMF7), also known as CRACC, CD319, CD2-like receptor-activating cytotoxic cells, and CS1, is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. SLAMF7 is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells but not in promyelocytic, B-cell lines, or T-cell lines. In human NK cells, activated SLAMF7 transmits signals following association with the adaptor protein EAT-2 . In the absence of EAT-2, SLAMF7 potently inhibited natural killer cell function. It was also inhibitory in T cells, which are typically devoid of EAT-2. Thus, SLAMF7 can exert activating or inhibitory influences on cells of the immune system depending on cellular context and the availability of effector proteins.

Synonyms

SLAMF7; 19A; CD319; CRACC; CS1

Gene ID

57823

UniProt

Q9NQ25

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/21kDa/22kDa/25kDa/32kDa/37kDa Observed MW: 25-70KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLAMF7 Rabbit pAb (APR29921N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57823

Uniprot URL

https://www.uniprot.org/uniprot/Q9NQ25

AA Sequence

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NEK3 AAV siRNA Pooled Vector
31707161 1.0 μg

NEK3 AAV siRNA Pooled Vector

Ask
View Details
Alpha-actin polyclonal antibody
BS62517 50ul

Alpha-actin polyclonal antibody

Ask
View Details
Human signal transducer and activator of transcription 2, STAT2 ELISA KIT
E0675Hu-01 48 Well

Human signal transducer and activator of transcription 2, STAT2 ELISA KIT

Ask
View Details
Human signal transducer and activator of transcription 2, STAT2 ELISA KIT
E0675Hu-02 96 Well

Human signal transducer and activator of transcription 2, STAT2 ELISA KIT

Ask
View Details
Human signal transducer and activator of transcription 2, STAT2 ELISA KIT
E0675Hu-03 5x 96 Tests

Human signal transducer and activator of transcription 2, STAT2 ELISA KIT

Ask
View Details
Human signal transducer and activator of transcription 2, STAT2 ELISA KIT
E0675Hu-04 10x 96 Tests

Human signal transducer and activator of transcription 2, STAT2 ELISA KIT

Ask
View Details