Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPSF1 Rabbit pAb (APR29760N)

Product Specifications

Background

Cleavage and polyadenylation specificity factor (CPSF) is a multisubunit complex that plays a central role in 3-prime processing of pre-mRNAs. CPSF recognizes the AAUAAA signal in the pre-mRNA and interacts with other proteins to facilitate both RNA cleavage and poly (A) synthesis. CPSF1 is the largest subunit of the CPSF complex (Murthy and Manley, 1995 [PubMed 7590244]) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CPSF1 Rabbit pAb (APR23540N4) .

Synonyms

CPSF1; CPSF160; HSU37012; P/cl.18

Gene ID

29894

UniProt

Q10570

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 160kDa Observed MW: 170kDa/185kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29894

Uniprot URL

https://www.uniprot.org/uniprot/Q10570

AA Sequence

LYRDLSGMFTTESRLGGARDELGGRSGPEAEGLGSETSPTVDDEEEMLYGDSGSLFSPSKEEARRSSQPPADRDPAPFRAEPTHWCLLVRENGTMEIYQLPDWRLVFLVKNFPVGQRVLVDSSFGQPTTQGEARREEATRQGELPLVKEVLLVALGSRQSRPYLLVHVDQELLIYEAFPHDSQLGQGNLKVRFKKVPHNINFREKKPKPSKKKAEGGGAEEGAGARGRVARFRYFEDIYGYSGVFICGPSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPRTP2 3'UTR Luciferase Stable Cell Line
TU010134 1.0 mL

HPRTP2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
N-terminal Arginylation Antibody (ATTO488)
abx440377-01 100 µg

N-terminal Arginylation Antibody (ATTO488)

Sign In for Pricing
View Details
N-terminal Arginylation Antibody (ATTO488)
abx440377-02 25 µg

N-terminal Arginylation Antibody (ATTO488)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yojO (yojO), partial
MBS1098928 Inquire

Recombinant Bacillus subtilis Uncharacterized protein yojO (yojO), partial

Sign In for Pricing
View Details
Olr1358 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7416108 1.0 µg DNA

Olr1358 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Phospho-HSP27/HSPB1-S78 Rabbit mAb
AP1032-01 20 µL

Phospho-HSP27/HSPB1-S78 Rabbit mAb

Sign In for Pricing
View Details