Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIC1 Rabbit pAb (APR28639N)

Product Specifications

Background

This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HIC1 Rabbit pAb (APR28639N) .

Synonyms

HIC1; ZBTB29; ZNF901; hic-1

Gene ID

3090

UniProt

Q14526

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 74kDa/76kDa Observed MW: 76kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3090

Uniprot URL

https://www.uniprot.org/uniprot/Q14526

AA Sequence

AATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEAAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERGGDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf225 (NM_001109334) Rat Tagged Lenti ORF Clone
RR205170L3 10 µg

Rnf225 (NM_001109334) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PPARA Rabbit Polyclonal Antibody (FITC)
orb2135593 100 µL

PPARA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HRH4 (NM_001160166) Human Tagged Lenti ORF Clone
RC228024L4 10 µg

HRH4 (NM_001160166) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DERL2-set siRNA/shRNA/RNAi Lentivector (Human)
18038091 4x 500 ng

DERL2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Recombinant Human V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR), partial
orb2986434-01 20 µg

Recombinant Human V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR), partial

Sign In for Pricing
View Details
Recombinant Human V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR), partial
orb2986434-02 100 µg

Recombinant Human V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR), partial

Sign In for Pricing
View Details