Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPARA Rabbit Polyclonal Antibody (FITC)

PPARA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Anon-EST:Liang-1.32, CG18103, CG31608, CG44122, CG8486, clone 1.32, Dmel\CG44122, Dmpiezo, DmPiezo, DmPIEZO, fos28F, fos500, OrfKD, piezo

UniProt

Q07869

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPARA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal EVA1/MPZL2 Antibody (OTI2C7) [DyLight 350]
NBP2-71553UV 0.1 mL

Mouse Monoclonal EVA1/MPZL2 Antibody (OTI2C7) [DyLight 350]

Sign In for Pricing
View Details
Neurotensin Protein, Human, Recombinant (hFc Tag)
MBS8121879-01 0.1 mg

Neurotensin Protein, Human, Recombinant (hFc Tag)

Sign In for Pricing
View Details
Neurotensin Protein, Human, Recombinant (hFc Tag)
MBS8121879-02 5x 0.1 mg

Neurotensin Protein, Human, Recombinant (hFc Tag)

Sign In for Pricing
View Details
Bisindolylmaleimide V
sc-202080A 5 mg

Bisindolylmaleimide V

Sign In for Pricing
View Details
Mouse ECF ELISA Kit (Ready to Use)
orb553314-01 48 Tests

Mouse ECF ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Mouse ECF ELISA Kit (Ready to Use)
orb553314-02 96 Tests

Mouse ECF ELISA Kit (Ready to Use)

Sign In for Pricing
View Details