Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS11A Rabbit pAb (APR28379N)

Product Specifications

Background

Probable serine protease which may play a role in cellular senescence. Overexpression inhibits cell growth and induce G1 cell cycle arrest.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TMPRSS11A Rabbit pAb (APR28379N) .

Synonyms

TMPRSS11A; ECRG1

Gene ID

339967

UniProt

Q6ZMR5

Cellular Locus

Membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 47kDa Observed MW: 48kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=339967

Uniprot URL

https://www.uniprot.org/uniprot/Q6ZMR5

AA Sequence

SASFQPNLTVHITGFGALYYGGESQNDLREARVKIISDDVCKQPQVYGNDIKPGMFCAGYMEGIYDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRNWIASKTGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOJ, ID (RHOJ, ARHJ, RASL7B, RHOI, TCL, Rho-related GTP-binding protein RhoJ, Ras-like protein family member 7B, Tc10-like GTP-binding protein) (PE)
MBS6341993-01 0.2 mL

RHOJ, ID (RHOJ, ARHJ, RASL7B, RHOI, TCL, Rho-related GTP-binding protein RhoJ, Ras-like protein family member 7B, Tc10-like GTP-binding protein) (PE)

Sign In for Pricing
View Details
RHOJ, ID (RHOJ, ARHJ, RASL7B, RHOI, TCL, Rho-related GTP-binding protein RhoJ, Ras-like protein family member 7B, Tc10-like GTP-binding protein) (PE)
MBS6341993-02 5x 0.2 mL

RHOJ, ID (RHOJ, ARHJ, RASL7B, RHOI, TCL, Rho-related GTP-binding protein RhoJ, Ras-like protein family member 7B, Tc10-like GTP-binding protein) (PE)

Sign In for Pricing
View Details
Human DNAAF3 knockdown cell line
ABC-KD4270 1 Vial

Human DNAAF3 knockdown cell line

Sign In for Pricing
View Details
MIR4679-2 Human MicroRNA Expression Plasmid (MI0017311)
SC401823 10 µg

MIR4679-2 Human MicroRNA Expression Plasmid (MI0017311)

Sign In for Pricing
View Details
ALPPL2 Rabbit Polyclonal Antibody
E53P08457 100 µL

ALPPL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Qser1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4579206 1.0 µg DNA

Qser1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details