Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNG10 Rabbit pAb (APR28210N)

Product Specifications

Background

Guanine nucleotide-binding proteins (G proteins are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GNG10 Rabbit pAb (APR28210N) .

Synonyms

GNG10

Gene ID

2790

UniProt

P50151

Cellular Locus

Cell membrane, Cytoplasmic side, Lipid-anchor

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 7kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2790

Uniprot URL

https://www.uniprot.org/uniprot/P50151

AA Sequence

MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTCSB2 CRISPRa sgRNA lentivector (set of three targets)(Human)
30868121 3x 1.0µg DNA

MTCSB2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae rplT Protein (aa 1-119) (strain NCCP11945)
VAng-Wyb2347-500gEcoli 500 µg (E. coli)

Recombinant Neisseria Gonorrhoeae rplT Protein (aa 1-119) (strain NCCP11945)

Sign In for Pricing
View Details
Menin (MEN1) (NM_130799) Human Mutant ORF Clone
RC403672 10 µg

Menin (MEN1) (NM_130799) Human Mutant ORF Clone

Sign In for Pricing
View Details
Canine High Mobility Group AT Hook Protein 1 (HMGA1) ELISA Kit
RDR-HMGA1-c-96Tests 96 Tests

Canine High Mobility Group AT Hook Protein 1 (HMGA1) ELISA Kit

Sign In for Pricing
View Details
Zfp275 Rabbit Polyclonal Antibody (HRP)
orb2115152 100 µL

Zfp275 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Sheep Mucin-5 subtype AC, Tracheobronchial (MUC5AC) ELISA Kit
abx364051 96 Well

Sheep Mucin-5 subtype AC, Tracheobronchial (MUC5AC) ELISA Kit

Sign In for Pricing
View Details