Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp275 Rabbit Polyclonal Antibody (HRP)

Zfp275 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DXP, DXBay2, DXHXS5, DXPas8, DXBay20, DXHXS52, AI593314, 5430431L06Rik

UniProt

A2AIE7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_113682

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLCD2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
46754151 3x 1.0 µg DNA

TLCD2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
BMP4 (NM_001202) Human Recombinant Protein
PH32441E9 50 µg

BMP4 (NM_001202) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Morone saxatilis Homeobox protein Hox-A7 (hoxa7)
MBS1310427-01 0.02 mg (E-Coli)

Recombinant Morone saxatilis Homeobox protein Hox-A7 (hoxa7)

Sign In for Pricing
View Details
Recombinant Morone saxatilis Homeobox protein Hox-A7 (hoxa7)
MBS1310427-02 0.1 mg (E-Coli)

Recombinant Morone saxatilis Homeobox protein Hox-A7 (hoxa7)

Sign In for Pricing
View Details
Recombinant Morone saxatilis Homeobox protein Hox-A7 (hoxa7)
MBS1310427-03 0.02 mg (Yeast)

Recombinant Morone saxatilis Homeobox protein Hox-A7 (hoxa7)

Sign In for Pricing
View Details
Recombinant Morone saxatilis Homeobox protein Hox-A7 (hoxa7)
MBS1310427-04 0.1 mg (Yeast)

Recombinant Morone saxatilis Homeobox protein Hox-A7 (hoxa7)

Sign In for Pricing
View Details