Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LLGL2 Rabbit pAb (APR28087N)

Product Specifications

Background

The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC) . In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LLGL2 Rabbit pAb (APR28087N) .

Synonyms

LLGL2; HGL; Hugl-2; LGL2

Gene ID

217325

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 114kDa Observed MW: 113kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=217325

AA Sequence

RQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSSHKRRPGGPTGEAQAQAVNIKAERTGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLRDSSRHCPSLWAGTNGGTVYAFSLRVPPAERRTDEPVRAEQAKEIQLMHRAPVVGILVLDGHNVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-Cyclin C (S275) CCNC Antibody
A05832S275 100 µL

Anti-Phospho-Cyclin C (S275) CCNC Antibody

Sign In for Pricing
View Details
ULBP2 Rabbit Polyclonal Antibody (HRP)
orb479948 100 µL

ULBP2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Peroxiredoxin 6 (PRDX6, 1-Cys, AOP2, KIAA0106, MGC46173, NSGPx, PRX, aiPLA2, p29) (APC)
MBS6431238-01 0.1 mL

Peroxiredoxin 6 (PRDX6, 1-Cys, AOP2, KIAA0106, MGC46173, NSGPx, PRX, aiPLA2, p29) (APC)

Sign In for Pricing
View Details
Peroxiredoxin 6 (PRDX6, 1-Cys, AOP2, KIAA0106, MGC46173, NSGPx, PRX, aiPLA2, p29) (APC)
MBS6431238-02 5x 0.1 mL

Peroxiredoxin 6 (PRDX6, 1-Cys, AOP2, KIAA0106, MGC46173, NSGPx, PRX, aiPLA2, p29) (APC)

Sign In for Pricing
View Details
Human DRAXIN Knockout HEK293T cell line
GTR15412208 1 Vial

Human DRAXIN Knockout HEK293T cell line

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS602417 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details