Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5/C5a Rabbit pAb (APR27960N)

Product Specifications

Background

This gene encodes a component of the complement system, a part of the innate immune system that plays an important role in inflammation, host homeostasis, and host defense against pathogens. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the C5 alpha chain, C5 beta chain, C5a anaphylatoxin and C5b. The C5 protein is comprised of the C5 alpha and beta chains, which are linked by a disulfide bridge. Cleavage of the alpha chain by a convertase enzyme results in the formation of the C5a anaphylatoxin, which possesses potent spasmogenic and chemotactic activity, and the C5b macromolecular cleavage product, a subunit of the membrane attack complex (MAC) . Mutations in this gene cause complement component 5 deficiency, a disease characterized by recurrent bacterial infections. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality C5/C5a Rabbit pAb (APR27960N) .

Synonyms

C5; C5D; C5a; C5b; CPAMD4; ECLZB

Gene ID

727

UniProt

P01031

Cellular Locus

Secreted

Applications

WB (Mus musculus) IHC (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 188kDa Observed MW: 74KDa/110KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=727

Uniprot URL

https://www.uniprot.org/uniprot/P01031

AA Sequence

SITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UTP18 (UTP18 Small Subunit (SSU) Processome Component Homolog, UTP18 Small Subunit Processome Component, CGI-48, U3 Small Nucleolar RNA-associated Protein 18 Homolog, WD Repeat-containing Protein 50, WD Repeat Domain 50, WDR50)
U7015-48 100 µg

UTP18 (UTP18 Small Subunit (SSU) Processome Component Homolog, UTP18 Small Subunit Processome Component, CGI-48, U3 Small Nucleolar RNA-associated Protein 18 Homolog, WD Repeat-containing Protein 50, WD Repeat Domain 50, WDR50)

Ask
View Details
NLGN4X (Neuroligin-4, X-linked, Neuroligin X, HNLX, KIAA1260, NLGN4, UNQ365/PRO701, ASPGX2, AUTSX2, MGC22376) (MaxLight 650)
MBS6387103-01 0.1 mL

NLGN4X (Neuroligin-4, X-linked, Neuroligin X, HNLX, KIAA1260, NLGN4, UNQ365/PRO701, ASPGX2, AUTSX2, MGC22376) (MaxLight 650)

Ask
View Details
NLGN4X (Neuroligin-4, X-linked, Neuroligin X, HNLX, KIAA1260, NLGN4, UNQ365/PRO701, ASPGX2, AUTSX2, MGC22376) (MaxLight 650)
MBS6387103-02 5x 0.1 mL

NLGN4X (Neuroligin-4, X-linked, Neuroligin X, HNLX, KIAA1260, NLGN4, UNQ365/PRO701, ASPGX2, AUTSX2, MGC22376) (MaxLight 650)

Ask
View Details
MARV GP/Envelope glycoprotein Antibody
E55A13468 100 µg

MARV GP/Envelope glycoprotein Antibody

Ask
View Details
NAA50 Antibody
MBS1493613-01 0.05 mL

NAA50 Antibody

Ask
View Details
NAA50 Antibody
MBS1493613-02 0.1 mL

NAA50 Antibody

Ask
View Details