Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCG5 Rabbit pAb (APR28366N)

Product Specifications

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the White subfamily. The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene may contribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ABCG5 Rabbit pAb (APR28366N) .

Synonyms

ABCG5; STSL

Gene ID

64240

UniProt

Q9H222

Cellular Locus

Membrane, Multi-pass membrane protein

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa/72kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64240

Uniprot URL

https://www.uniprot.org/uniprot/Q9H222

AA Sequence

TLPMVPFKTKDSPGVFSKLGVLLRRVTRNLVRNKLAVITRLLQNLIMGLFLLFFVLRVRSNVLKGAIQDRVGLLYQFVGATPYTGMLNAVNLFPVLRAVSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAL Rabbit Polyclonal Antibody (APC)
orb1002957 100 µL

GAL Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
5'-Adenylic acid discontinued
371113 5 mg

5'-Adenylic acid discontinued

Sign In for Pricing
View Details
CD54 (Intercellular Adhesion Molecule, ICAM-1) discontinued
C2409-21 500 µL

CD54 (Intercellular Adhesion Molecule, ICAM-1) discontinued

Sign In for Pricing
View Details
Oprm1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K5026004 1.0 µg DNA

Oprm1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
GPR158 Protein Lysate (Rat) with C-HA Tag
22524036 100 µg

GPR158 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Lentiviral mouse Slc1a6 shRNA (UAS) - Lentiviral mouse Slc1a6 shRNA (UAS, iRFP) (100)
GTR15286899 1 Vial

Lentiviral mouse Slc1a6 shRNA (UAS) - Lentiviral mouse Slc1a6 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details