Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF3 Rabbit pAb (APR27957N)

Product Specifications

Background

ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2, and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARF3 Rabbit pAb (APR27957N) .

Synonyms

ARF3

Gene ID

377

UniProt

P61204

Cellular Locus

Cytoplasm, Golgi apparatus, perinuclear region

Dilution

IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=377

Uniprot URL

https://www.uniprot.org/uniprot/P61204

AA Sequence

MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD79A, CT (CD79A, IGA, MB1, B Cell antigen receptor complex-associated protein alpha chain, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein, CD_antigen=CD79a) (PE) discontinued
030862-PE 200 µL

CD79A, CT (CD79A, IGA, MB1, B Cell antigen receptor complex-associated protein alpha chain, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein, CD_antigen=CD79a) (PE) discontinued

Ask
View Details
Hsp40 Mouse Monoclonal Antibody
AMM03613-01 50 µL

Hsp40 Mouse Monoclonal Antibody

Ask
View Details
Hsp40 Mouse Monoclonal Antibody
AMM03613-02 100 µL

Hsp40 Mouse Monoclonal Antibody

Ask
View Details
Hsp40 Mouse Monoclonal Antibody
AMM03613-03 200 µL

Hsp40 Mouse Monoclonal Antibody

Ask
View Details
SPDL1 (Protein Spindly, hSpindly, Arsenite-related Gene 1 Protein, Coiled-coil Domain-containing Protein 99, Rhabdomyosarcoma Antigen MU-RMS-40.4A, Spindle Apparatus Coiled-coil Domain-containing Protein 1, CCDC99, FLJ20364, FLJ40690)
MBS6000394-01 0.1 mg

SPDL1 (Protein Spindly, hSpindly, Arsenite-related Gene 1 Protein, Coiled-coil Domain-containing Protein 99, Rhabdomyosarcoma Antigen MU-RMS-40.4A, Spindle Apparatus Coiled-coil Domain-containing Protein 1, CCDC99, FLJ20364, FLJ40690)

Ask
View Details
SPDL1 (Protein Spindly, hSpindly, Arsenite-related Gene 1 Protein, Coiled-coil Domain-containing Protein 99, Rhabdomyosarcoma Antigen MU-RMS-40.4A, Spindle Apparatus Coiled-coil Domain-containing Protein 1, CCDC99, FLJ20364, FLJ40690)
MBS6000394-02 5x 0.1 mg

SPDL1 (Protein Spindly, hSpindly, Arsenite-related Gene 1 Protein, Coiled-coil Domain-containing Protein 99, Rhabdomyosarcoma Antigen MU-RMS-40.4A, Spindle Apparatus Coiled-coil Domain-containing Protein 1, CCDC99, FLJ20364, FLJ40690)

Ask
View Details