Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HE4/WFDC2 Rabbit pAb (APR26849N)

Product Specifications

Background

This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HE4/WFDC2 Rabbit pAb (APR26849N) .

Synonyms

WFDC2; EDDM4; HE4; WAP5; dJ461P17.6

Gene ID

10406

UniProt

Q14508

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 8kDa/11kDa/12kDa Observed MW: 20KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10406

Uniprot URL

https://www.uniprot.org/uniprot/Q14508

AA Sequence

LVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CLEC4A/DCIR Protein (His Tag)
PKSH031113 50 µg

Recombinant Human CLEC4A/DCIR Protein (His Tag)

Sign In for Pricing
View Details
Cytokeratin 15 (KRT15) Rabbit Polyclonal Antibody
AP06196PU-N 100 µg

Cytokeratin 15 (KRT15) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VEGFR2 (Ab-951) Antibody
8B7254-AAT 50 µg

VEGFR2 (Ab-951) Antibody

Sign In for Pricing
View Details
Rab18 Mouse Gene Knockout Kit (CRISPR)
KN514336 1 Kit

Rab18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lamin A (LMNA) Mouse Monoclonal Antibody [Clone ID: 4E7]
AM06658SU-N 100 µL

Lamin A (LMNA) Mouse Monoclonal Antibody [Clone ID: 4E7]

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1842), 1mg/mL
BNUM1842-50 1x 50 µL

CD79b (B-Cell Marker) (IGB/1842), 1mg/mL

Sign In for Pricing
View Details