Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mast Cell Chymase (CMA1) Rabbit pAb (APR25997N)

Product Specifications

Background

This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Mast Cell Chymase (CMA1) Rabbit pAb (APR25997N) .

Synonyms

CMA1; CYH; MCT1; chymase

Gene ID

1215

UniProt

P23946

Cellular Locus

Cytoplasmic granule, Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/27kDa Observed MW: 27kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1215

Uniprot URL

https://www.uniprot.org/uniprot/P23946

AA Sequence

ITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM192 siRNA Oligos set (Human)
46974171 3x 5 nmol

TMEM192 siRNA Oligos set (Human)

Sign In for Pricing
View Details
KDM1B Human Gene Knockout Kit (CRISPR)
KN421980 1 Kit

KDM1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Eno4 activation kit by CRISPRa
GA213845 1 Kit

Mouse Eno4 activation kit by CRISPRa

Sign In for Pricing
View Details
pBluescriptR-DMRTC2 Plasmid
PVT21215 2 µg

pBluescriptR-DMRTC2 Plasmid

Sign In for Pricing
View Details
Hepatitis B Virus E antigen detected in Serum (HbeAg)
C4123 40 Tests

Hepatitis B Virus E antigen detected in Serum (HbeAg)

Sign In for Pricing
View Details
POTEF, ID (POTEF, A26C1B, POTE ankyrin domain family member F, ANKRD26-like family C member 1B, Chimeric POTE-actin protein) (FITC) discontinued
040282-FITC 200 µL

POTEF, ID (POTEF, A26C1B, POTE ankyrin domain family member F, ANKRD26-like family C member 1B, Chimeric POTE-actin protein) (FITC) discontinued

Sign In for Pricing
View Details