Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mammaglobin-A (SCGB2A2)

Product Specifications

Product Name Alternative

Mammaglobin-1 (Secretoglobin family 2A member 2)

Abbreviation

Recombinant Human SCGB2A2 protein

Gene Name

SCGB2A2

UniProt

Q13296

Expression Region

19-93aa

Organism

Homo sapiens (Human)

Target Sequence

GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Tags & Cell Markers

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.5 kDa

References & Citations

"Highly sensitive detection of the MGB1 transcript (mammaglobin) in the peripheral blood of breast cancer patients." Cerveira N., Torres L., Rocha P., Bizarro S., Pereira D., Abreu J., Henrique R., Teixeira M.R., Castedo S. Int. J. Cancer 108:592-595 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam134b 3'UTR GFP Stable Cell Line
TU156149 1.0 mL

Fam134b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-SCA2 Rabbit pAb
GB112402-50 50 μL

Anti-SCA2 Rabbit pAb

Sign In for Pricing
View Details
1700001O22Rik (NM_198000) Mouse Tagged Lenti ORF Clone
MR205826L3 10 µg

1700001O22Rik (NM_198000) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
2-[ (1R,2S) -1-Ethyl-2- (phenylmethoxy) propyl]hydrazinecarboxaldehyde
414436-01 1 mg

2-[ (1R,2S) -1-Ethyl-2- (phenylmethoxy) propyl]hydrazinecarboxaldehyde

Sign In for Pricing
View Details
2-[ (1R,2S) -1-Ethyl-2- (phenylmethoxy) propyl]hydrazinecarboxaldehyde
414436-02 2.5 mg

2-[ (1R,2S) -1-Ethyl-2- (phenylmethoxy) propyl]hydrazinecarboxaldehyde

Sign In for Pricing
View Details
CGNL1 rabbit pAb
RA31582-01 50 µL

CGNL1 rabbit pAb

Sign In for Pricing
View Details