Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5B Rabbit pAb (APR25359N)

Product Specifications

Background

This gene encodes a member of a family of inositol polyphosphate-5-phosphatases. These enzymes function in the regulation of calcium signaling by inactivating inositol phosphates. The encoded protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus. Alternatively spliced transcript variants of this gene have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality INPP5B Rabbit pAb (APR25359N) .

Synonyms

INPP5B; 5PTase

Gene ID

3633

UniProt

P32019

Cellular Locus

Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Early endosome membrane, Endoplasmic reticulum-Golgi intermediate compartment, Golgi apparatus, Membrane, Peripheral membrane protein, cytosol, phagosome membrane

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 85kDa/93kDa/103kDa/112kDa Observed MW: 113kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3633

Uniprot URL

https://www.uniprot.org/uniprot/P32019

AA Sequence

MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRMFLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYT

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rack (HxD) 6x4=24 boxes, 50mm, 334x562x140mm, Sliding, B10
TE24236B10 1 Piece

Rack (HxD) 6x4=24 boxes, 50mm, 334x562x140mm, Sliding, B10

Ask
View Details
COMMD8 Rabbit Polyclonal Antibody
E28PN8080 100 µL

COMMD8 Rabbit Polyclonal Antibody

Ask
View Details
SLC9A3 (NM_004174) Human Tagged ORF Clone Lentiviral Particle
RC210976L1V 200 µL

SLC9A3 (NM_004174) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
HLA Class 2 Antigen DRB1, NT (HLA Class II Histocompatibility Antigen DRB1-1 beta Chain, HLA-DR1B, HLA-DRB1, HLA-DRB1*, HLA-DRB, DR1, DR-1, DRB1, DRw10, FLJ75017, FLJ76359, MHC Class II Antigen DRB1*1, SS1) (FITC)
MBS6480967-01 0.2 mL

HLA Class 2 Antigen DRB1, NT (HLA Class II Histocompatibility Antigen DRB1-1 beta Chain, HLA-DR1B, HLA-DRB1, HLA-DRB1*, HLA-DRB, DR1, DR-1, DRB1, DRw10, FLJ75017, FLJ76359, MHC Class II Antigen DRB1*1, SS1) (FITC)

Ask
View Details
HLA Class 2 Antigen DRB1, NT (HLA Class II Histocompatibility Antigen DRB1-1 beta Chain, HLA-DR1B, HLA-DRB1, HLA-DRB1*, HLA-DRB, DR1, DR-1, DRB1, DRw10, FLJ75017, FLJ76359, MHC Class II Antigen DRB1*1, SS1) (FITC)
MBS6480967-02 5x 0.2 mL

HLA Class 2 Antigen DRB1, NT (HLA Class II Histocompatibility Antigen DRB1-1 beta Chain, HLA-DR1B, HLA-DRB1, HLA-DRB1*, HLA-DRB, DR1, DR-1, DRB1, DRw10, FLJ75017, FLJ76359, MHC Class II Antigen DRB1*1, SS1) (FITC)

Ask
View Details