Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A Rabbit pAb (APR24546N)

Product Specifications

Background

MRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1 Rex protein and of human immunodeficiency virus type 1 (HIV-1 Rev protein, essential for mRNA export of retroviral transcripts.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality eIF5A Rabbit pAb (APR24546N) .

Synonyms

EIF5A; EIF-5A; EIF5A1; eIF5AI

Gene ID

1984

UniProt

P63241

Cellular Locus

Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Nucleus, Peripheral membrane protein, nuclear pore complex

Applications

WB ()

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/20kDa Observed MW: 17kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1984

Uniprot URL

https://www.uniprot.org/uniprot/P63241

AA Sequence

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant mouse Peroxiredoxin 2/PRDX2 protein
ATGP3684-250 250 µg

Recombinant mouse Peroxiredoxin 2/PRDX2 protein

Sign In for Pricing
View Details
P2RY13 sgRNA CRISPR Lentivector (Human) (Target 2)
K1583103 1.0 µg DNA

P2RY13 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Nodal Recombinant Antibody, HRP Conjugated
bsm-62611R-HRP 100 µL

Nodal Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
BCLX Rabbit Polyclonal Antibody
orb304697-01 30 µL

BCLX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCLX Rabbit Polyclonal Antibody
orb304697-02 50 μL

BCLX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCLX Rabbit Polyclonal Antibody
orb304697-03 100 µL

BCLX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details