Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM76A Rabbit Polyclonal Antibody (FITC)

FAM76A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC34648, RP3-426I6.1

UniProt

Q8TAV0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM76A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEXSY BHI - Powder Media Kit
M-ML-412XL 10 L

LEXSY BHI - Powder Media Kit

Sign In for Pricing
View Details
Mouse Monoclonal Mast Cell Marker Antibody (MCG35) [PE]
NBP2-50484PE 0.1 mL

Mouse Monoclonal Mast Cell Marker Antibody (MCG35) [PE]

Sign In for Pricing
View Details
Anti-AER61 Rabbit Monoclonal Antibody
MA1109-.05 50 µL

Anti-AER61 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DYNLRB2, ID (DYNLRB2, DNCL2B, DNLC2B, ROBLD2, Dynein light chain roadblock-type 2, Dynein light chain 2B, cytoplasmic, Roadblock domain-containing protein 2) (FITC) discontinued
034874-FITC 200 µL

DYNLRB2, ID (DYNLRB2, DNCL2B, DNLC2B, ROBLD2, Dynein light chain roadblock-type 2, Dynein light chain 2B, cytoplasmic, Roadblock domain-containing protein 2) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Leptospira Biflexa rplC protein (aa 1-207)
VAng-Wyb0163-50gEcoli 50 µg (E. coli)

Recombinant Leptospira Biflexa rplC protein (aa 1-207)

Sign In for Pricing
View Details
Olfr913 CRISPR Activation Plasmid (m)
sc-434402-ACT 20 µg

Olfr913 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details