Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR8 Rabbit pAb (APR23932N)

Product Specifications

Background

This gene encodes a member of the myotubularin-related family and is part of the MTMR6 subgroup. Family members are dual-specificity phosphatases and the encoded protein contains a phosphoinositide-binding domain (PID) and a SET-interacting domain (SID) . Defects in other family members have been found in myotubular myopathic diseases. [provided by RefSeq, Mar 2010]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MTMR8 Rabbit pAb (APR23932N) .

Synonyms

MTMR8

Gene ID

55613

UniProt

Q96EF0

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 66kDa/78kDa Observed MW: 79kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55613

Uniprot URL

https://www.uniprot.org/uniprot/Q96EF0

AA Sequence

HVFSCQFGNFLGNCQKDREDLRVYEKTHSVWPFLVQRKPDFRNPLYKGFTMYGVLNPSTVPYNIQFWCGMYNRFDKGLQPKQSMLESLLEIKKQRAMLETDVHELEKKLKVRDEPPEEICTCSQLGNILSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCE1 CRISPR/Cas9 KO Plasmid (m)
sc-422628 20 µg

RCE1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
C14orf23 Protein Vector (Human) (pPB-N-His)
PV065638 500 ng

C14orf23 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Fatty Acid Binding Protein 6, Ileal (FABP6)
MBS2012309-01 0.01 mg

Recombinant Fatty Acid Binding Protein 6, Ileal (FABP6)

Sign In for Pricing
View Details
Recombinant Fatty Acid Binding Protein 6, Ileal (FABP6)
MBS2012309-02 0.05 mg

Recombinant Fatty Acid Binding Protein 6, Ileal (FABP6)

Sign In for Pricing
View Details
Recombinant Fatty Acid Binding Protein 6, Ileal (FABP6)
MBS2012309-03 0.1 mg

Recombinant Fatty Acid Binding Protein 6, Ileal (FABP6)

Sign In for Pricing
View Details
Recombinant Fatty Acid Binding Protein 6, Ileal (FABP6)
MBS2012309-04 0.2 mg

Recombinant Fatty Acid Binding Protein 6, Ileal (FABP6)

Sign In for Pricing
View Details