Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DPA1 Rabbit pAb (APR23786N)

Product Specifications

Background

HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages) . The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HLA-DPA1 Rabbit pAb (APR23786N) .

Synonyms

HLA-DPA1; DP (W3) ; DP (W4) ; HLA-DP1A; HLADP; HLASB; PLT1; class II

Gene ID

3113

UniProt

P20036

Cellular Locus

Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Golgi apparatus, Lysosome membrane, Single-pass type I membrane protein, trans-Golgi network membrane

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3113

Uniprot URL

https://www.uniprot.org/uniprot/P20036

AA Sequence

YAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPET

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal CA125/MUC16 Antibody (oregovomab) [Janelia Fluor 585]
NBP3-28081JF585 0.1 mL

Human Monoclonal CA125/MUC16 Antibody (oregovomab) [Janelia Fluor 585]

Sign In for Pricing
View Details
Human Myelin basic protein ELISA Kit
MBS2881550-01 48 Well

Human Myelin basic protein ELISA Kit

Sign In for Pricing
View Details
Human Myelin basic protein ELISA Kit
MBS2881550-02 96 Well

Human Myelin basic protein ELISA Kit

Sign In for Pricing
View Details
Human Myelin basic protein ELISA Kit
MBS2881550-03 5x 96 Well

Human Myelin basic protein ELISA Kit

Sign In for Pricing
View Details
Human Myelin basic protein ELISA Kit
MBS2881550-04 10x 96 Well

Human Myelin basic protein ELISA Kit

Sign In for Pricing
View Details
Invopressin
MF-0157830-01 5 mg

Invopressin

Sign In for Pricing
View Details